Malware Domain List

Malware Related => Malicious Domains => Topic started by: boston on October 28, 2011, 05:52:04 pm

Title: Black hole
Post by: boston on October 28, 2011, 05:52:04 pm
xttp://safenesscontent.ru/s4one/index.php -> xttp://paybucksinternet.ru/allow.php?page=ce7e6bb7d9eb6c7a -> xttp://paybucksinternet.ru/w.php?f=84&e=2
xttp://payment-glonas.in/position/index.php -> xttp://office-electronic.in/allow.php?page=19909cd93a1a78f6 ->  xttp://office-electronic.in/w.php?f=84&e=2
http://urlquery.net/report.php?id=6456
http://urlquery.net/report.php?id=6459
http://www.virustotal.com/file-scan/report.html?id=51e506e83218b276675622ce81d59c4356aa39738bd0c0c39bfaabb1839bd054-1319819808
Title: Re: Black hole
Post by: boston on November 02, 2011, 09:10:04 pm
xttp://safenesscontent.ru/s4one/index.php -> xttp://activation-card.ru/allow.php?page=ce7e6bb7d9eb6c7a(already listed) -> xttp://activation-card.ru/w.php?f=84&e=2

http://urlquery.net/report.php?id=7094
http://r.virscan.org/report/658f9d78a2d0519a7d584ce16a92e8f8.html
Title: Re: Black hole
Post by: boston on November 05, 2011, 08:51:54 pm
xttp://editions-hydromel.com/Scripts/swfobject_modified.js -> xttp://safenesscontent.ru/s4one/index.php -> xttp://deposit-consulting.ru/allow.php?page=19909cd93a1a78f6 ->  xttp://deposit-consulting.ru/w.php?f=130&e=2
http://urlquery.net/report.php?id=7449
http://www.virustotal.com/file-scan/report.html?id=48d28c89f010c87c1949f612d238f1bff0c078def3a9de1d95ea7a741bd7de32-1320517408
Title: Re: Black hole
Post by: boston on November 06, 2011, 11:00:55 pm
xttp://editions-hydromel.com/Scripts/swfobject_modified.js -> xttp://safenesscontent.ru/s4one/index.php -> xttp://certificatecontroller.ru/allow.php?page=19909cd93a1a78f6 -> xttp://certificatecontroller.ru/w.php?f=130&e=2
http://urlquery.net/report.php?id=7498
http://r.virscan.org/report/30469c8f287335f133a927b5ad0cac3c.html
Title: Re: Black hole
Post by: boston on November 07, 2011, 11:20:20 pm
xttp://advertisingteaser.ru/allow.php?page=19909cd93a1a78f6 -> xttp://advertisingteaser.ru/w.php?f=130&e=2
http://urlquery.net/report.php?id=7655
http://www.virustotal.com/file-scan/report.html?id=7ae1deace2b5e18a46b7b90e81208c1eb5629810bb81679ec348f80a2b6e42a8-1320707140
Title: Re: Black hole
Post by: boston on November 08, 2011, 12:46:01 pm
xttp://teaser-network.ru/allow.php?page=19909cd93a1a78f6 -> xttp://teaser-network.ru/w.php?f=130&e=2
http://urlquery.net/report.php?id=7710
http://r.virscan.org/report/634553ef22b1a381358daecf4d20da49.html
Title: Re: Black hole
Post by: DnlMrx on November 08, 2011, 02:44:35 pm
Did somebody have Infos about the version of these Blackhole exploitkits?
Title: Re: Black hole
Post by: boston on November 10, 2011, 09:52:11 pm
the urlquery-results provide information about the version.
*
xttp://protect-holes.ru/allow.php?page=bf5de6c328ce79e3 -> xttp://protect-holes.ru/w.php?f=130&e=2
http://urlquery.net/report.php?id=8080
http://www.virustotal.com/file-scan/report.html?id=8eb5ce720ee51f916c84b247ec4e495ae54cbe6a3b28a6410a282bf5ff028af1-1320948771
Title: Re: Black hole
Post by: boston on November 11, 2011, 08:54:49 pm
xttp://holesprotect.ru/allow.php?page=bf5de6c328ce79e3 -> xttp://holesprotect.ru/w.php?f=141&e=2
http://urlquery.net/report.php?id=8235
http://www.virustotal.com/file-scan/report.html?id=c3aafae4fdfd9967249fec02ee7757bf0f078f89559d696f15cd908478e23137-1321044456
Title: Re: Black hole
Post by: boston on November 12, 2011, 10:08:32 pm
xttp://protectwindows.ru/allow.php?page=bf5de6c328ce79e3 -> xttp://protectwindows.ru/w.php?f=141&e=2
http://urlquery.net/report.php?id=8263
http://www.virustotal.com/file-scan/report.html?id=a282598686a6e7d917bfd7688e87b8f40ac974a6573b030e412ce707eed7308d-1321131629
Title: Re: Black hole
Post by: boston on November 19, 2011, 04:12:15 pm
xttp://propaintball.pl -> xttp://speedpiramid.in/liman/index.php -> xttp://grammaticsupport.in/allow.php?page=14b02962aeac3888
-> xttp://grammaticsupport.in/w.php?f=141&e=2

xttp://grammatic.in/allow.php?page=14b02962aeac3888 -> xttp://grammatic.in/w.php?f=141&e=2

http://urlquery.net/report.php?id=9055
http://urlquery.net/report.php?id=9056
http://www.virustotal.com/file-scan/report.html?id=e531543a6077cceb6a1c6dd4ad26d11ce0a3f5c83bf60d5f46ea01fe9ee24e00-1321718270
Title: Re: Black hole
Post by: boston on November 20, 2011, 05:14:56 pm
xttp://plugandgrow.co.uk -> xttp://fruityboom.info/dason/index.php -> xttp://miss-aurora.info/allow.php?page=14b02962aeac3888
-> xttp://miss-aurora.info/w.php?f=141&e=2
http://urlquery.net/report.php?id=9138
http://www.virustotal.com/file-scan/report.html?id=e3403b6b148058f038ddb2727cc8b5da6094efaeed0dec67634490681da0395e-1321808668
Title: Re: Black hole
Post by: boston on November 20, 2011, 09:10:04 pm
xttp://misscaptivitymovie.info/allow.php?page=14b02962aeac3888 -> xttp://misscaptivitymovie.info/w.php?f=141&e=2
http://urlquery.net/report.php?id=9153
Title: Re: Black hole
Post by: boston on November 23, 2011, 05:45:46 pm
xttp://nightmare.org -> xttp://dndelectric.info/jero/index.php -> xttp://tahit.info/www.php?page=b5af6db59003531d
-> xttp://tahit.info/w.php?f=153&e=2
http://urlquery.net/report.php?id=9512
http://www.virustotal.com/file-scan/report.html?id=d9ad58c63c3d6651359510a9d571274907e84a1f83326877ddbeff109e19cd45-1322069669
Title: Re: Black hole
Post by: boston on November 24, 2011, 04:00:22 pm
xttp://comptechgrp.info/gizm/index.php -> xttp://androidpanties.info/www.php?page=b5af6db59003531d
-> xttp://androidpanties.info/w.php?f=153&e=8
http://wepawet.cs.ucsb.edu/view.php?hash=c0f2caa853915b1bb646484ba3e215cb&t=1322150145&type=js
http://www.virustotal.com/file-scan/report.html?id=c34b0634124716bb2007648e661c3fea1feb6baed13319c5a8c9233131f323f0-1322149739
Title: Re: Black hole
Post by: boston on November 25, 2011, 07:27:04 pm
xttp://kawaiiexchange.com -> xttp://sturtupgeografyc.in/gabon/index.php
+
xttp://graphictutorial.com -> xttp://sturtup-geografyc.in/tandir/index.php
-> xttp://alarm-news.in/www.php?page=b5af6db59003531d -> xttp://alarm-news.in/w.php?f=153&e=8

xttp://news-alarm.in/www.php?page=b5af6db59003531d -> xttp://news-alarm.in/w.php?f=153&e=8

http://wepawet.cs.ucsb.edu/view.php?hash=634abb778c1601a92dc94b468c04ed08&t=1322248525&type=js
http://www.virustotal.com/file-scan/report.html?id=7e10988a856e519a608ae50eccc0b663f59ac4e8da9315305668e2b14c76fdd4-1322243093

Title: Re: Black hole
Post by: boston on November 25, 2011, 09:33:42 pm
xttp://news-grammatic.in/www.php?page=b5af6db59003531d -> xttp://news-grammatic.in/w.php?f=153&e=8
http://wepawet.cs.ucsb.edu/view.php?hash=408ae9eca7e6a949858ff57dac3f2f6e&t=1322256563&type=js
http://www.virustotal.com/file-scan/report.html?id=d97107adf1263a4c56ce7af3ca4abfad1757c44122137a26e00dcda26a2a2037-1322256152
Title: Re: Black hole
Post by: boston on November 26, 2011, 06:48:47 pm
xttp://settingstat.in/ribai/index.php -> xttp://anadirion.in/www.php?page=b5af6db59003531d -> xttp://anadirion.in/w.php?f=153&e=8
http://www.virustotal.com/file-scan/report.html?id=9904a3128187fd98b58aa4dd25757b320a3cffb409928bd3556796b77cfeb8e0-1322332542
http://wepawet.cs.ucsb.edu/view.php?hash=0653d2563fd61d8b58bd14639416eee8&t=1322332982&type=js
Title: Re: Black hole
Post by: boston on November 29, 2011, 09:44:34 pm
xttp://cc-agri.com leads to fake av and black hole, payload is zbot.
http://wepawet.cs.ucsb.edu/view.php?hash=cdb8ce34827ad98edff878e092b6925f&t=1322601346&type=js
xttp://95.168.187.22/files/42bfc0e082c9371cded75e6c42e9f156e0d6225af111bb91.exe
http://www.virustotal.com/file-scan/report.html?id=1d3ff00825bafa48241944c0ae28a078bbc139f2b79a6a2037d985bf9b7398bd-1322601775
xttp://makerstok.com/main.php?page=a8b7c278bc226865 -> xttp://makerstok.com/w.php?f=21&e=8
http://www.virustotal.com/file-scan/report.html?id=e4048696376646f9fbe28ae0f3a94aeb3f5401b3a9edfaae7cf7af136d99e861-1322601486
Title: Re: Black hole
Post by: boston on December 04, 2011, 09:06:53 pm
xttp://pimpol672304.co.cc/main.php?page=257ef5eed2a723e8 -> xttp://pimpol672304.co.cc/w.php?f=53&e=8
http://wepawet.cs.ucsb.edu/view.php?hash=1ccd081c840bcaca0f3c716d05cda4d4&t=1323032256&type=js
http://www.virustotal.com/file-scan/report.html?id=adf23a5131cf878dc2c74fe704f164b9a7e01e162e517928bc79657c5838140a-1323031874
Title: Re: Black hole
Post by: boston on December 05, 2011, 07:04:22 pm
xttp://theenergycenter.org/ -> xttp://fgdgdfgttr.twilightparadox.com/  -> xttp://z180502.infobox.ru/index.php 
-> xttp://pimpol672337.co.cc/main.php?page=257ef5eed2a723e8  -> xttp://pimpol672337.co.cc/w.php?f=53&e=8
http://wepawet.cs.ucsb.edu/view.php?hash=24232b61b8aff6d45f154afa458de4b8&t=1323110669&type=js
http://www.virustotal.com/file-scan/report.html?id=319693684ae9f0fba937861a2a4c8b80cb6a0535c2a07a94d4274b7f693f5776-1323110443


Title: Re: Black hole
Post by: boston on December 06, 2011, 10:26:31 pm
iframe from xttp://ilmondodidany.it/ leads to
xttp://jghkeqjroucggqetg.nl.ai/main.php?page=8487b19ab9bbce03 -> xttp://jghkeqjroucggqetg.nl.ai/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=8a95b5031af7aae37af95b1f52a1c304&t=1323209856&type=js
http://www.virustotal.com/file-scan/report.html?id=74cf9d60f2fa62aa2c8a8bc5dc24d0edb81a7df12167feeaad3f5e80ebdf144c-1323209567
Title: Re: Black hole
Post by: boston on December 07, 2011, 07:53:01 pm
xttp://azondsondex.ru/adsong/index.php -> xttp://egnom-omitec.ru/main.php?page=64756d1c9639eb25
-> xttp://egnom-omitec.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=fcc9b528659b4a11d1db5dbb2c102892&t=1323287220&type=js
http://www.virustotal.com/file-scan/report.html?id=e12b654409e89cc7ba90b7fa611c6d2598911830a715b212847523c0917c6373-1323286854
Title: Re: Black hole
Post by: boston on December 09, 2011, 07:21:44 pm
xttp://collection-paradise.ru/acorp/index.php -> xttp://updatelast.ru/main.php?page=64756d1c9639eb25
-> xttp://updatelast.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=f8464a2ec83b20be2fc7f2f7dd69a3bb&t=1323458285&type=js
Title: Re: Black hole
Post by: boston on December 11, 2011, 09:44:54 pm
xttp://sitemoved.bij.pl/main.php?page=e71ba5a840b27af9 -> xttp://sitemoved.bij.pl/w.php?f=28&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=7cdd003f9a193779682674ea27d5ea67&t=1323638868&type=js
http://www.virustotal.com/file-scan/report.html?id=a68a1aaea65d3569752892a79f760c1cd8e707631ec5284758f75d524c4207f5-1323639114
Title: Re: Black hole
Post by: boston on December 14, 2011, 05:57:04 pm
xttp://arcoconstalling.ru/original/index.php -> xttp://send-spark.ru/main.php?page=1016f363104dcd01
-> xttp://send-spark.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=1f1d7a80a099a04cd34e50c06648a29d&t=1323885180&type=js
http://www.virustotal.com/file-scan/report.html?id=d06ebb257e14b6e1c58e9649435d94e019996d7266672d472b8967f12bde1b4a-1323884948
Title: Re: Black hole
Post by: boston on December 14, 2011, 09:31:21 pm
xttp://spark-send.ru/main.php?page=1016f363104dcd01 -> xttp://spark-send.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=574856ac6ee50d97dc7c885c51b15882&t=1323897991&type=js
http://www.virustotal.com/file-scan/report.html?id=3fa7d5bf1c8af0f1b5c32e2752220176140f9f2c4149ef1bc3e2f9e7f8d130d7-1323897723
Title: payload: zbot
Post by: boston on December 15, 2011, 08:49:41 pm
xttp://bedthese.com/main.php?page=899f002ea96106b0 -> xttp://bedthese.com/w.php?f=53&e=6
xttp://loaddocsfast.servehttp.com/main.php?page=899f002ea96106b0 -> xttp://loaddocsfast.servehttp.com/w.php?f=53&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=b4aee2e0efc6a5bb43765baf202072a9&t=1323981219&type=js
http://www.virustotal.com/file-scan/report.html?id=b375097717ab7832342347f873b929b9ecc5fe51b23c05ee805008b563fd1f4e-1323980844
http://www.threatexpert.com/report.aspx?md5=019bf818eec90b5bc428c329a4ee3b36
Title: payload: zbot
Post by: boston on December 15, 2011, 10:13:16 pm
xttp://ragsmog.com/main.php?page=899f002ea96106b0 -> xttp://ragsmog.com/w.php?f=53&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=013c2b2079a537c9d78059ad601e2385&t=1323986819&type=js
http://www.virustotal.com/file-scan/report.html?id=37be24b7b0c4213dc27ac9b5dcdcd8786e3e37673a35885be7ba6f1276382209-1323986690
Title: payload: zbot
Post by: boston on December 17, 2011, 09:51:30 am
xttp://bedwill.com/main.php?page=899f002ea96106b0 -> xttp://bedwill.com/w.php?f=95&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=7ff9a005aae63105943fc9c1f835c595&t=1324115200&type=js   
http://www.virustotal.com/file-scan/report.html?id=bf552de81a14c5f8128b358afee53d22c06769f17f2cf1f6c57218a5067f2077-1324114921
Title: payload: zbot
Post by: boston on December 17, 2011, 08:29:40 pm
xttp://freefreefree.sytes.net/main.php?page=899f002ea96106b0 -> xttp://freefreefree.sytes.net/w.php?f=53&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=9b5e4c137153f57624a133000a9a6caf&t=1324152729&type=js
http://www.virustotal.com/file-scan/report.html?id=2cd38a8af12619d18a0dc5160f0db7ed38765d49f2e3e01da259ca47a7f3a9be-1324152501

Title: Re: Black hole
Post by: boston on December 29, 2011, 05:50:31 pm
xttp://float-spacer.ru/access/index.php ->  xttp://paddingdisplay.ru/main.php?page=b67137fa79c9e463
-> xttp://paddingdisplay.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=a505653128143fe104d4ce5c4e3e9f43&t=1325180629&type=js
http://www.virustotal.com/file-scan/report.html?id=754c2a2a58bde71930b3e3b10d9c3925464dc355bc92b457e8c7c1165b3453cd-1325180485
Title: Re: Black hole
Post by: boston on December 29, 2011, 09:14:02 pm
xttp://displayline.ru/main.php?page=b67137fa79c9e463 -> xttp://displayline.ru/w.php?f=25&e=6   
http://wepawet.cs.ucsb.edu/view.php?hash=30270003c2d0920f393bc4060175e6c9&t=1325192202&type=js
http://r.virscan.org/report/17b104b6e6d4b7fd568dfdec2742e0ac.html
Title: Re: Black hole
Post by: boston on January 06, 2012, 07:25:53 am
xttp://answerfloat.ru/access/index.php -> xttp://headcont-http.ru/main.php?page=b67137fa79c9e463
-> xttp://headcont-http.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=ecc5a0022a869e920b2572b012bbe943&t=1325834248&type=js
http://www.virustotal.com/file-scan/report.html?id=29a8f70c82fb8c80b3851bc6ec12ca424f48eac79d5ed074925044f1ecfb6d18-1325834127
Title: Re: Black hole
Post by: boston on January 07, 2012, 07:41:40 pm
xttp://get-byid.ru/ruby/index.php -> xttp://equiv-http.ru/main.php?page=fa047a36d524d1ea 
-> xttp://equiv-http.ru/w.php?f=25&e=6    
http://wepawet.cs.ucsb.edu/view.php?hash=75e3c0d85cfef6242a5e66b3c83baa03&t=1325964731&type=js
http://www.virustotal.com/file-scan/report.html?id=59249e31ddd218f4da17bec8d3a9463dde865c137add9ce4eae5fb84d225b1e2-1325964461
Title: Re: Black hole
Post by: boston on January 11, 2012, 07:41:20 am
xttp://shortcuticon.ru/access/index.php -> xttp://generationbox.ru/main.php?page=fa047a36d524d1ea
->  xttp://generationbox.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=8264a16136dc15af9966e787fa2addc8&t=1326267350&type=js
http://www.virustotal.com/file-scan/report.html?id=fc5c2c1597ab1118d443ce63289d72412b92ed9d884c8a466dd1dabd82a32c73-1326267035
Title: Re: Black hole
Post by: boston on January 11, 2012, 11:31:13 am
xttp://shortcut-icon.ru/access/index.php -> xttp://box-fresh.ru/main.php?page=fa047a36d524d1ea
-> xttp://box-fresh.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=423dba8f2815242ba98eb06d5c0dbbbe&t=1326281191&type=js
http://www.virustotal.com/file-scan/report.html?id=f93574b69c10ded0dde804b999bee4b12a9f3acc24d4aa2c2a455c3543fe00d1-1326280993
Title: Re: Black hole
Post by: boston on January 14, 2012, 07:31:28 pm
xttp://gradient-header.ru/gamma/index.php -> xttp://setup-mouseover.in/main.php?page=56121227efa16f9a
-> xttp://mouseover-setup.in/w.php?f=25&e=6
http://wepawet.iseclab.org/view.php?hash=03d808ad55b79355bf8f8a70c4b9b783&t=1326568962&type=js
https://www.virustotal.com/file/01e45e5a2d67b66b9d29325b249ca556ea704f364eda68de7c3f294018c33a2e/analysis/1326569178/
Title: Re: Black hole
Post by: boston on January 14, 2012, 10:29:06 pm
xttp://intervalhits.in/main.php?page=56121227efa16f9a -> xttp://intervalhits.in/w.php?f=25&e=6
http://wepawet.iseclab.org/view.php?hash=67c0e6e67b66c99e04f305a9f73da557&t=1326579736&type=js
https://www.virustotal.com/file/cb0c4276fea48208e4b24f4ffbf5d8d4d1558b170a87df01a9484ad5b24e9cd7/analysis/1326579879/
Title: Re: Black hole
Post by: boston on January 15, 2012, 08:46:28 am
xttp://interval-lement.in/main.php?page=56121227efa16f9a -> xttp://interval-lement.in/w.php?f=25&e=6
http://wepawet.iseclab.org/view.php?hash=ffe8344cc257e1089c25f7ddb6a9523f&t=1326616799&type=js
https://www.virustotal.com/file/76d46c21db0878a1fbd039f6be81aa97e7ea5494c5b3f3e0c456d42c924c2d27/analysis/1326616949/
Title: Re: Black hole
Post by: boston on January 15, 2012, 02:22:53 pm
xttp://hitslement.in/main.php?page=56121227efa16f9a -> xttp://hitslement.in/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=c79d9d83696f08de9677e28179fa2cc6&t=1326636942&type=js
https://www.virustotal.com/file/8a266a6576fef2fcb0b517c8c385e0b3a662be2248450a57e0962caecab7f8fa/analysis/1326637148/
Title: Re: Black hole
Post by: boston on January 16, 2012, 06:13:48 pm
xttp://saveprefs.ru/astro/index.php -> xttp://setupelement.ru/main.php?page=56121227efa16f9a
-> xttp://setupelement.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=0b26824e62f5b5c6d9844145dfcf552c&t=1326737310&type=js
https://www.virustotal.com/file/dcbb5f0e3742f6c8c85c9e39f41d51ccbd1102625455e427e3323d4410e0ee92/analysis/1326737449/
Title: Re: Black hole
Post by: boston on January 16, 2012, 10:00:32 pm
xttp://elementsetup.ru/main.php?page=56121227efa16f9a -> xttp://elementsetup.ru/w.php?f=25&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=07eb59f163bc6e6830b6c8ef3328d667&t=1326750957&type=js
https://www.virustotal.com/file/0c6f7e639ee654b56e8c54a5140a78e4d727d98722fdcac8f75f0cf1a2468792/analysis/1326751076/
Title: Re: Black hole
Post by: boston on January 21, 2012, 03:50:27 pm
xttp://divstylechange.ru/vis/index.php -> xttp://page-submitted.ru/main.php?page=1aa080c8910868f8
-> xttp://page-submitted.ru/w.php?f=45&e=3
http://r.virscan.org/report/fb6738b9671ebc1b021d7d805ae86b5b.html
Title: Re: Black hole
Post by: boston on January 21, 2012, 06:19:30 pm
xttp://pagesupport.ru/main.php?page=1aa080c8910868f8 -> xttp://pagesupport.ru/w.php?f=45&e=3
Title: Re: Black hole
Post by: boston on January 22, 2012, 07:06:32 am
xttp://locationonclick.ru/vis/index.php -> xttp://nusgobomko.ru/main.php?page=47a76b488c8a18b4
-> xttp://nusgobomko.ru/w.php?f=45&e=2 / xttp://nusgobomko.ru/w.php?f=45&e=6

xttp://kaetp-nusgo.ru/main.php?page=47a76b488c8a18b4 -> xttp://kaetp-nusgo.ru/w.php?f=45&e=2 / xttp://kaetp-nusgo.ru/w.php?f=45&e=6
http://r.virscan.org/report/fe95eb5918e7ccf20a60d2e9ee872bce.html
Title: Re: Black hole
Post by: boston on January 22, 2012, 01:50:22 pm
xttp://lookonclick.ru/vis/index.php -> xttp://bomko-nusgo.ru/main.php?page=47a76b488c8a18b4
-> xttp://bomko-nusgo.ru/w.php?f=45&e=6
Title: Re: Black hole
Post by: boston on January 22, 2012, 03:38:49 pm
xttp://look-onclick.ru/vis/index.php -> xttp://kaetp.ru/main.php?page=47a76b488c8a18b4 -> xttp://kaetp.ru/w.php?f=45&e=2

Title: Re: Black hole
Post by: boston on January 22, 2012, 07:02:36 pm
xttp://kaetpbomko.ru/main.php?page=47a76b488c8a18b4 -> xttp://kaetpbomko.ru/w.php?f=45&e=2
http://r.virscan.org/report/9f17d34dd33431d84c05596fcbed3cae.html
Title: Re: Black hole
Post by: boston on January 23, 2012, 03:00:09 pm
xttp://locationlook.ru/vis/index.php -> xttp://munkakorto.ru/main.php?page=47a76b488c8a18b4
-> xttp://munkakorto.ru/w.php?f=45&e=2

xttp://korto-munka.ru/main.php?page=47a76b488c8a18b4 -> xttp://korto-munka.ru/w.php?f=45&e=2
Title: Re: Black hole
Post by: boston on January 23, 2012, 07:32:58 pm
xttp://gerku.ru/main.php?page=47a76b488c8a18b4 -> xttp://gerku.ru/w.php?f=45&e=2
http://r.virscan.org/report/556895895cd5c12b7e14b006eb388ff2.html
Title: Re: Black hole
Post by: boston on January 24, 2012, 10:23:37 am
xttp://leapofdeservtationonthebask-framethemainsitewithconf.nl.ai/main.php?page=0b1d33626f0dd96a
-> xttp://leapofdeservtationonthebask-framethemainsitewithconf.nl.ai/w.php?f=17&e=2
https://www.virustotal.com/file/f45f082c9b5c5abf0dbffdd80d32138fdb222ce42366b4fa09d6a954fddaefee/analysis/1327399869/
Title: Re: Black hole
Post by: boston on January 24, 2012, 03:32:55 pm
xttp://doublediet.com/main.php?page=ff3fc1bbc7eac87c -> xttp://doublediet.com/w.php?f=16&e=2    
https://www.virustotal.com/file/0538b0777559b9acd5b887c52aa4f39da3f55462477c96f3124e9e3cc28ebc72/analysis/
Title: Re: Black hole
Post by: boston on January 24, 2012, 09:06:50 pm
xttp://chillemap.com/search.php?page=977334ca118fcb8c -> xttp://chillemap.com/d.php?f=82&e=2
https://www.virustotal.com/file/7ff74f30c062b9169af9a35c27b0d60c5ea7782366e2e29dbc83f1836a23c2cf/analysis/1327439040/
Title: Re: Black hole
Post by: boston on January 25, 2012, 08:18:05 am
xttp://chillestruct.com/search.php?page=977334ca118fcb8c -> xttp://chillestruct.com/d.php?f=82&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=1f01b50c5df86095b486d31457420076&t=1327478902&type=js
https://www.virustotal.com/file/52ef9d683ac0cdf1b01c2652e9a0101320f9eca5aa22362ecd28195acd2576ac/analysis/1327479239/
Title: Re: Black hole
Post by: boston on January 25, 2012, 01:37:26 pm
xttp://brainbin.com/main.php?page=f01569c984bcc11c -> xttp://brainbin.com/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=1e5d3dc542fe70c4c8226fc2badb7190&t=1327498272&type=js
https://www.virustotal.com/file/eb5de3c553204ae2ef41df61c6ca9fa84c86183527e0c869e18bb890bd21fd1b/analysis/1327498459/
Title: Re: Black hole
Post by: boston on January 25, 2012, 04:18:00 pm
xttp://tozusnjm.electronicstalker.info/nasha.php?radost=c50673f513a5c1f1
-> xttp://tozusnjm.electronicstalker.info/p.php?f=17&e=2    
https://www.virustotal.com/file/bdb86d1a0027926a9f1e9c09cb77d4c3c9b3e946363c7e3107d5a3d279e910e2/analysis/1327508063/
Title: Re: Black hole
Post by: boston on January 25, 2012, 07:17:29 pm
xttp://mvomhqko.geachile.cl/nasha.php?radost=c50673f513a5c1f1 -> xttp://mvomhqko.geachile.cl/p.php?f=17&e=2
https://www.virustotal.com/file/bdb86d1a0027926a9f1e9c09cb77d4c3c9b3e946363c7e3107d5a3d279e910e2/analysis/1327518960/
Title: Re: Black hole
Post by: boston on January 25, 2012, 09:58:46 pm
xttp://obgjgddy.buzlylabs.com/nasha.php?radost=c50673f513a5c1f1 -> xttp://obgjgddy.buzlylabs.com/p.php?f=17&e=2
https://www.virustotal.com/file/bdb86d1a0027926a9f1e9c09cb77d4c3c9b3e946363c7e3107d5a3d279e910e2/analysis/
Title: Re: Black hole
Post by: boston on January 25, 2012, 10:43:19 pm
xttp://ouacqode.freezed.info/nasha.php?radost=c50673f513a5c1f1 -> xttp://ouacqode.freezed.info/p.php?f=17&e=2
https://www.virustotal.com/file/bdb86d1a0027926a9f1e9c09cb77d4c3c9b3e946363c7e3107d5a3d279e910e2/analysis/1327531245/
Title: payload: zbot
Post by: boston on January 26, 2012, 06:05:49 pm
xttp://richequine.com/main.php?page=f01569c984bcc11c -> xttp://richequine.com/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=e353891454cbe42ec252325eb9590010&t=1327600606&type=js
Title: Re: Black hole
Post by: boston on January 27, 2012, 08:00:50 am
xttp://wnkpbdpl.tzhome.tk/nasha.php?radost=c50673f513a5c1f1 -> xttp://wnkpbdpl.tzhome.tk/p.php?f=17&e=2
https://www.virustotal.com/file/0cdae83b41b1cea2edff89258d611149a2202686503f2c93090db67728bf8fe7/analysis/1327651068/
Title: payload: zbot
Post by: boston on January 27, 2012, 11:33:09 am
xttp://srichco.com/main.php?page=f01569c984bcc11c -> xttp://srichco.com/w.php?f=16&e=3
http://urlquery.net/report.php?id=18057
Title: Re: Black hole
Post by: boston on January 27, 2012, 11:42:22 am
xttp://ssldtbuz.ru-xxero.com/nasha.php?radost=c50673f513a5c1f1 -> xttp://ssldtbuz.ru-xxero.com/p.php?f=17&e=2
https://www.virustotal.com/file/0cdae83b41b1cea2edff89258d611149a2202686503f2c93090db67728bf8fe7/analysis/
Title: Re: Black hole
Post by: boston on January 27, 2012, 12:27:36 pm
xttp://seriusmazaloa.com/main.php?page=fcc979cea719d1bc -> xttp://seriusmazaloa.com/w.php?f=60&e=2
https://www.virustotal.com/file/873c81e90d55874d3fdd285ddeafaa079851522e40fa95c72f3c581e55db92ae/analysis/1327667004/
Title: Re: Black hole
Post by: boston on January 27, 2012, 07:25:07 pm
xttp://ehpfuqbf.lazim.org/nasha.php?radost=c50673f513a5c1f1 -> xttp://ehpfuqbf.lazim.org/p.php?f=17&e=2
https://www.virustotal.com/file/0cdae83b41b1cea2edff89258d611149a2202686503f2c93090db67728bf8fe7/analysis/1327692075/
Title: Re: Black hole
Post by: boston on January 28, 2012, 09:48:36 am
xttp://pkasixbo.madymaes.com/nasha.php?radost=c50673f513a5c1f1 -> xttp://pkasixbo.madymaes.com/p.php?f=17&e=2
http://wepawet.cs.ucsb.edu/view.php?hash=00951cae8b9c3af6fa04726e61ea79c3&type=js
https://www.virustotal.com/file/d346985bf4cd80deadf58550b0a793428475732bddc58c00d7db2d53cdd511ce/analysis/
Title: Re: Black hole
Post by: boston on January 28, 2012, 05:16:46 pm
xttp://lastsavehorsepleaze.in/search.php?s=c5ea04fb12c6c4f2 -> xttp://lastsavehorsepleaze.in/a.php?f=22&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=e6d10e468105c3f17e07c8251cc6a471&t=1327770706&type=js
https://www.virustotal.com/file/0a6d5bc81ef037d24481872e371940a3c21c46bc659d584554cad2df0ae4484d/analysis/
Title: Re: Black hole
Post by: boston on January 29, 2012, 02:59:57 pm
xttp://trf.roicg.com/main.php?page=f01569c984bcc11c -> xttp://trf.roicg.com/w.php?f=16&e=6   
http://wepawet.cs.ucsb.edu/view.php?hash=7935d5de85f35c748d0cec6e5920284f&t=1327848623&type=js
https://www.virustotal.com/file/e8497756f2b6f1bda5c979a16ae443f575c4cfc86854aa4730aa3ca9fbddc0d8/analysis/
Title: Re: Black hole
Post by: boston on February 01, 2012, 04:07:08 pm
xttp://mvzlqzxncg.zyns.com/main.php?page=48b54f175f2657ec -> xttp://mvzlqzxncg.zyns.com/w.php?f=16&e=6
https://www.virustotal.com/file/0db0c0d43af301e41f135fda7326cdefc6b01de1b06e57cd4de08bd0f3bb6903/analysis/1328112211/
Title: Re: Black hole
Post by: boston on February 01, 2012, 07:55:31 pm
xttp://zudoqssl.beechwoodsoftware.com/nasha.php?radost=c50673f513a5c1f1 -> xttp://zudoqssl.beechwoodsoftware.com/p.php?f=17&e=2
https://www.virustotal.com/file/d6eb9a1a5b27e783124c32ba7eefec443db03bd9fb26ad142f080d1b54ca47c4/analysis/
Title: Re: Black hole
Post by: boston on February 02, 2012, 08:20:09 pm
xttp://ww.hanbokdress.com/main.php?page=f01569c984bcc11c -> xttp://ww.hanbokdress.com/w.php?f=16&e=6
http://wepawet.iseclab.org/view.php?hash=ae18c62048b9ef8c464e7bb7ca1a348e&t=1328213756&type=js
http://r.virscan.org/report/490dd34a6056c796fc3f2cfc41ade7e8.html
Title: Re: Black hole
Post by: boston on February 06, 2012, 08:27:54 pm
xttp://egpazyxw.drunkenfood.com/nasha.php?radost=c50673f513a5c1f1 -> xttp://egpazyxw.drunkenfood.com/p.php?f=17&e=2
https://www.virustotal.com/file/672b549b291160bdda36efbfe795b2146fa3481b9db31bfb469f548122c697a4/analysis/1328559882/
Title: payload: zbot
Post by: boston on February 07, 2012, 03:16:58 pm
xttp://qw.regionredbirds.com/main.php?page=f01569c984bcc11c -> xttp://qw.regionredbirds.com/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=0a822f177a0bf7c4c27a87b5d513e095&t=1328626827&type=js
Title: Re: Black hole
Post by: boston on February 08, 2012, 06:49:38 pm
xttp://leilourantenes.redirectme.net/main.php?page=794312a8837f3511 -> xttp://leilourantenes.redirectme.net/w.php?f=21&e=6
https://www.virustotal.com/file/64187a8a511516308973da5cc46b6c3d4db0ceb06c43459ca01fa30a688677a7/analysis/
Title: payload: zbot
Post by: boston on February 09, 2012, 06:11:36 pm
xttp://as.handbless.com/main.php?page=f01569c984bcc11c -> xttp://as.handbless.com/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=c90f54648103e042a0cf46d98cd4d4ef&t=1328810672&type=js
Title: Re: Black hole
Post by: boston on February 11, 2012, 03:18:59 pm
xttp://wrerds.dns-stuff.com/main.php?page=5d6a3721ddd20fb8 -> xttp://wrerds.dns-stuff.com/w.php?f=16&e=6
https://www.virustotal.com/file/7102af009085b560acde324a3b2a4c6336a7b54c4823696b3166401e9474ecaa/analysis/1328973013/
Title: payload: zbot
Post by: boston on February 13, 2012, 08:34:25 am
xttp://zx.jencurcio.com/main.php?page=f01569c984bcc11c -> xttp://zx.jencurcio.com/w.php?f=16&e=3
http://urlquery.net/report.php?id=20892
Title: Re: Black hole
Post by: boston on February 14, 2012, 12:31:21 pm
xttp://pancclear.com/main.php?page=43af371b668b9132 -> xttp://pancclear.com/w.php?f=17&e=4
https://www.virustotal.com/file/d67934b3bfe88b1f859aa659146e70926aadbb8a06a1efdb641912dfa345abd1/analysis/1329222411/
Title: Re: Black hole
Post by: boston on February 16, 2012, 08:18:49 am
fake av:
xttp://svyaz154.1dumb.com/main.php?page=bd9afdd8df7aa34c -> xttp://svyaz154.1dumb.com/w.php?f=23&e=6
Title: Re: Black hole
Post by: boston on February 16, 2012, 04:10:34 pm
xttp://golfgxsac.jelev.eu/main.php?page=d454c7023cdb6b92 -> xttp://golfgxsac.jelev.eu/w.php?f=22&e=6
https://www.virustotal.com/file/72284a6fdba8533a0142c18fa2222deb43f6c00168a37f8eb52d6847b35bdcdc/analysis/1329407981/
Title: payload: zbot
Post by: boston on February 16, 2012, 08:44:46 pm
xttp://bmegsjheqprhupouh.nl.ai/main.php?page=116af8920b9f1ed7 -> xttp://bmegsjheqprhupouh.nl.ai/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=a96e38cae71e284f2f9ee19c54513495&t=1329424175&type=js
https://www.virustotal.com/file/bbc0409a0cfb652bcd664b376740da40005efedac6eb5553720598d642b4e37b/analysis/1329424884/
Title: payload: zbot
Post by: boston on February 17, 2012, 09:09:37 am
xttp://ww.turningsbyterry.com/main.php?page=116af8920b9f1ed7 -> xttp://ww.turningsbyterry.com/w.php?f=16&e=6
http://wepawet.cs.ucsb.edu/view.php?hash=2dc46c81a8d4e9967ee232e527bccce5&t=1329469449&type=js
https://www.virustotal.com/file/bbc0409a0cfb652bcd664b376740da40005efedac6eb5553720598d642b4e37b/analysis/
Title: Re: Black hole
Post by: boston on February 17, 2012, 06:11:21 pm
xttp://foresigvqhc.jelev.eu/main.php?page=d454c7023cdb6b92 -> xttp://foresigvqhc.jelev.eu/w.php?f=25&e=6
https://www.virustotal.com/file/aea7d3148702f17301b8cacafb8ae627bc5f6e85f18e6a4da616221fe2bb247d/analysis/1329502148/
Title: Re: Black hole
Post by: boston on February 18, 2012, 06:43:54 am
xttp://unicelltee.jelev.eu/main.php?page=d454c7023cdb6b92 -> xttp://unicelltee.jelev.eu/w.php?f=25&e=6
https://www.virustotal.com/file/aea7d3148702f17301b8cacafb8ae627bc5f6e85f18e6a4da616221fe2bb247d/analysis/
Title: Re: Black hole
Post by: boston on February 19, 2012, 11:07:26 am
xttp://dialogutqc.jelev.eu/main.php?page=d454c7023cdb6b92 -> xttp://dialogutqc.jelev.eu/w.php?f=30&e=6
https://www.virustotal.com/file/cf0255180e746656cd61d66acaa36aadb84abb2f4aa8bc54a38118a3dcb65270/analysis/1329649041/
Title: Re: Black hole
Post by: boston on February 23, 2012, 08:02:24 am
xttp://mnofopolki.in/main.php?page=7d3248e7236658eb -> xttp://mnofopolki.in/w.php?f=97d19&e=3
http://urlquery.net/report.php?id=24086
https://www.virustotal.com/file/bca24072fc4c303b5b204183555c717cbe6a72794aeb76dcd69e659a123938bf/analysis/1329983972/
Title: Re: Black hole
Post by: boston on March 02, 2012, 04:34:15 pm
xttp://ghgttte5.in/main.php?page=7d3248e7236658eb -> xttp://ghgttte5.in/w.php?f=97d19&e=1
https://www.virustotal.com/file/36d46352e761d5c2f8738c7f2e95b1199d8de958d0a34468b317066e67573c60/analysis/1330705117/
Title: payload: spyeye
Post by: boston on March 04, 2012, 07:43:20 am
xttp://vdsnmertakflgsnfmdertapse-ferpdmfnvdbsmrthgjkdqzvmdfledf.nl.ai/main.php?page=0b1d33626f0dd96a
-> xttp://vdsnmertakflgsnfmdertapse-ferpdmfnvdbsmrthgjkdqzvmdfledf.nl.ai/w.php?f=cf234&e=1
https://www.virustotal.com/file/3990253b7b3fb1c1a958da91ae69193630697f22defca21e518ba93769fa53c7/analysis/1330845371/
Title: Re: Black hole
Post by: boston on March 30, 2012, 07:35:20 pm
xttp://www.preslinglar.trickip.net/index.php?ref=945fdef1aab164d6 -> xttp://www.preslinglar.trickip.net/w.php?f=4c27f&e=1
http://wepawet.cs.ucsb.edu/view.php?hash=cd8f404c3c0378ccdad64afc70e8d61f&t=1333132946&type=js
https://www.virustotal.com/file/317687b66c17a2cddb5648bd2d4a7698b7815526c2d3d88a6f53af576a68e3f1/analysis/
Title: Re: Black hole
Post by: boston on March 31, 2012, 09:28:06 am
xttp://www.posvecoo.toh.info/index.php?ref=945fdef1aab164d6 -> xttp://www.posvecoo.toh.info/w.php?f=4c27f&e=1
Title: Re: Black hole
Post by: boston on March 31, 2012, 11:59:13 am
xttp://kuletif.eu/main.php -> xttp://kuletif.eu/w.php?f=182b5&e=1
https://www.virustotal.com/file/fc8594df8f8f54dba5ab36ebccc831e098f7c953153bf226c875229b89620c0a/analysis/1333195005/
Title: Re: Black hole
Post by: boston on April 05, 2012, 11:21:26 am
xttp://qeryrhvcntrt.myfw.us/main.php?page=5d6a3721ddd20fb8 -> xttp://qeryrhvcntrt.myfw.us/w.php?f=97d19&e=1    
https://www.virustotal.com/file/b0cd25363036f519e46b61957613cdc5271ea31c233dafcaba43335fda294b0d/analysis/1333624199/
Title: Re: Black hole
Post by: boston on April 07, 2012, 04:31:00 pm
xttp://zuberingiostaor.in/main.php?page=07246c29deb93759 -> xttp://zuberingiostaor.in/w.php?f=5e91c&e=1
https://www.virustotal.com/file/715900c5895fe9ad04f22f850f62c94fa305c0a6fc17b33fcf139305ea390b4f/analysis/1333813052/
Title: Re: Black hole
Post by: boston on April 27, 2012, 01:47:27 pm
xttp://allanlacosse.com/main.php?page=5e0cdb0ca7f86ed0 -> xttp://allanlacosse.com/w.php?f=97d19&e=1
http://wepawet.cs.ucsb.edu/view.php?hash=690d812745b18574a39a55dab08ee79c&t=1335534057&type=js
https://www.virustotal.com/file/a16b6c2eb43b13c67e6b26711e58474a293c90020765f9498615dd05145f6147/analysis/
Title: Re: Black hole
Post by: boston on May 13, 2012, 09:49:23 pm
xttp://designbyallison.com/main.php?page=5e0cdb0ca7f86ed0
Title: Re: Black hole
Post by: boston on May 21, 2012, 03:14:51 pm
xttp://ynavqoayb.igg.biz/main.php?page=c69bd02e93e6957c
Title: Re: Black hole
Post by: EP_X0FF on June 04, 2012, 01:40:18 am
BH EK

Quote
hxxp://c336kl1.dyndns.biz/catalog.php?rio=f49988ac08b79415

http://wepawet.iseclab.org/view.php?hash=41254ebf21c46dcc95a34733153cba5d&t=1338773447&type=js

Quote
hxxp://c336kl1.dyndns.biz/files/fe0e4
hxxp://c336kl1.dyndns.biz/files/bb3e0
hxxp://c336kl1.dyndns.biz/files/86b3a
Title: Re: Black hole
Post by: boston on June 12, 2012, 06:56:17 pm
xttp://ww2.taylorgram.com/main.php?page=3081100e9fdaf127
http://wepawet.cs.ucsb.edu/view.php?hash=f64a4694d96803fb7130075a2519a784&t=1339526920&type=js
Title: payload: zbot
Post by: boston on July 26, 2012, 02:22:53 pm
xttp://readyforweekend.net/l/src.php?case=6251f7551d037da2
Title: payload: zbot
Post by: boston on July 26, 2012, 08:14:49 pm
xttp://74.91.118.234/view.php?s=bba2ae32701df84b
http://www.threatexpert.com/report.aspx?md5=047e5231bc3166dc3dae828166d05960
Title: Re: Black hole
Post by: dlipman on September 09, 2012, 09:52:56 pm
Have you noticed lately that when you try to analyze some BH EK sites such as;  http://adsnx.co.cc/main.php?page=5ddbacdb5beb3981

You'll get a result such as...
"No input file specified."

Title: Re: Black hole
Post by: boston on January 21, 2013, 07:40:51 pm
xttp://50fd804e645bb.chicagoprivateparties.com/news/GENE.PHTML
http://urlquery.net/report.php?id=792358
payload:
xttp://50fd804e645bb.chicagoprivateparties.com/news/Mutter_Homecoming4.exe
https://www.virustotal.com/file/acfe69174327f7f8146c47f9174d937f6b6f2ba12e14d2d767d08d10747a1679/analysis/1358797039/
Title: Blackhole redirs
Post by: michajp on April 11, 2013, 02:30:58 am
Confirmed active at 2013-04-11.11-30 (JST):

Code: [Select]
hxxp://avoer2012.unsri.ac.id/aleanto.htm
hxxp://bitas.timetest.ru/aleanto.htm
hxxp://bugs4u.info/aleanto.htm
hxxp://chekani.ru/aleanto.htm
hxxp://confederacy.zhilin.info/aleanto.htm
hxxp://creationbaymccom.ipage.com/serach.htm
hxxp://cs-vsi.myarena.ru/serach.htm
hxxp://dakar.by/aleanto.htm
hxxp://dalmis.net/aleanto.htm
hxxp://delta-mebel.by/gakmail.htm
hxxp://drupal.timetest.ru/aleanto.htm
hxxp://ergo.proxy.perso.neuf.fr/serach.htm
hxxp://flowpa.hu/aleanto.htm
hxxp://forum.in911.ru/aleanto.htm
hxxp://forums.gta-slim.ru/aleanto.htm
hxxp://goa.genealogie-bahn.de/aleanto.htm
hxxp://infoengr.net/aleanto.htm
hxxp://jan.krotky.free.fr/aleanto.htm
hxxp://just2play.ro/aleanto.htm
hxxp://kanasta.thebest.kao.pl/serach.htm
hxxp://kitti-kutyakozmetika.fh.rs/serach.htm
hxxp://minimonosdigital.tk/aleanto.htm
hxxp://netcat4full.timetest.ru/aleanto.htm
hxxp://netcat4.timetest.ru/aleanto.htm
hxxp://ohota-ural.com/aleanto.htm
hxxp://oldversion.samaraart.ru/aleanto.htm
hxxp://olimpprog.uupi.ru/serach.htm
hxxp://paytechsolutions.com/serach.htm
hxxp://pokrovhram.by/aleanto.htm
hxxp://possessionpointcharters.com/serach.htm
hxxp://privycouncil.hu/aleanto.htm
hxxp://rskshi5vida.ru/aleanto.htm
hxxp://shinndesign.com/aleanto.htm
hxxp://site.ruksadindan.com/aleanto.htm
hxxp://tank.timetest.ru/aleanto.htm
hxxp://tepekoydernegi.com/aleanto.htm
hxxp://time2life.ru/aleanto.htm
hxxp://tkbc.ru/aleanto.htm
hxxp://urfo-konkurs.uupi.ru/aleanto.htm
hxxp://vekilebe.com/aleanto.htm
hxxp://weissedrachen.de/aleanto.htm
hxxp://westie-be.com/gakmail.htm
hxxp://www.delta-mebel.by/gakmail.htm
hxxp://www.divorcecamp.com/gakmail.htm
hxxp://www.dravaszovetseg.hu/aleanto.htm
hxxp://www.globalac.by/gakmail.htm
hxxp://www.heidiscathouse.org/gakmail.htm
hxxp://www.ilcampodeigiochiblog.org/aleanto.htm
hxxp://www.koloniaostrowicka.boo.pl/aleanto.htm
hxxp://www.longbeachsurfshop.com/aleanto.htm
hxxp://www.lunchandlearn.ro/gakmail.htm
hxxp://www.medicinoserdve.lt/aleanto.htm
hxxp://www.melody-of-heart.de/aleanto.htm
hxxp://www.met-centr.ru/gakmail.htm
hxxp://www.nebesa.by/aleanto.htm
hxxp://www.nikonorisalo.com/aleanto.htm
hxxp://www.officiallifeent.com/gakmail.htm
hxxp://www.ourwatershed.ca/gakmail.htm
hxxp://www.polimt.ru/serach.htm
hxxp://www.pollena-astra.com.pl/gakmail.htm
hxxp://www.softaircenter.at/gakmail.htm
hxxp://www.tbgonline.biz/aleanto.htm
hxxp://www.tkbc.ru/aleanto.htm
hxxp://www.weissedrachen.de/aleanto.htm
hxxp://zagan.website.pl/aleanto.htm
hxxp://zkouska.net-fly.eu/aleanto.htm
hxxp://zsolti455.weboldala.net/aleanto.htm